Tags Word Games Scrabble Q&A

Animals & Plants Arts & Entertainment Auto Beauty & Health Books and Literature Business Electronics Engineering & Technology Food & Drink History Hobbies Jobs & Education Law & Government Math People & Society Science Social Studies Sports Travel & Places

0

Arts & Entertainment>Games

What are some 4 letter words with 'or' in the middle?

Updated: 9/10/2022

Wiki User

∙ 13y ago

Best Answer

Wiki User

∙ 13y ago

This answer is:

More answers

Sample name ∙

Lvl 2

∙ 1y ago

pneis

This answer is:

Anonymous ∙

Lvl 1

∙ 3y ago

By

This answer is:

Anonymous ∙

Lvl 1

∙ 3y ago

cord

This answer is:

Add your answer:

Earn +20 pts

Q: What are some 4 letter words with 'or' in the middle?

Write your answer...

Submit

Still have questions?

imp

Continue Learning about Games

Four letter word with au in the middle?

Some 4 letter words with 'au' in the middle:FauxHaulMaulTautSee the related link for a full list.

What are the 4-letter words with an ia in the middle?

Fiat, dial...

4 letter words with double E in the middle?

Jeep

What is a four letter word with it in the middle?

The word is with w-it-h\Other 4 letter words with it in the middle:bitecitecityfitshitskitskitelitemitepitsritesitesitswitszits

What 4 letter words that start with I?

Some four letter words that start with I are:ibexibisicedideainchintoisn'titch

Related questions

Four letter word with au in the middle?

Some 4 letter words with 'au' in the middle:FauxHaulMaulTautSee the related link for a full list.

What are the 4-letter words with an ia in the middle?

Fiat, dial...

4 letter words with double E in the middle?

Jeep

All 4 letter Christmas words?

Some 4 letter Christmas words are:treegiftbellwishloveshopsnowsale

What is a four letter word with it in the middle?

The word is with w-it-h\Other 4 letter words with it in the middle:bitecitecityfitshitskitskitelitemitepitsritesitesitswitszits

What are some 4 or 5 letter words that start with the letter w?

WHAT-WHEN-WHERE-WORDS

What are some 4 letter words that end in you?

Four letter words that end with U:ecrugurulieutofuthoubeaumenututu

What 4 letter words that start with I?

Some four letter words that start with I are:ibexibisicedideainchintoisn'titch

4 letter work starting with the letter a?

Some four letter words starting with A are:ableacreafarajaralsoaltoareaAsiaautoaxle

What 4 letter words have you as second letter?

Some four letter words with a second letter U are:auraburncurbcuredulldumbeurofundguruhugejumpjunklumpluremuchmutenudeoustpullpurepushrulerumpruinruserushrustsuchsurftune

What are some words that end with meth?

4-letter wordsmeth6-letter wordscometh9-letter wordsmeseemeth3 words found.

What are some 4 letter words ending with the letter H?

noah

Trending Questions

List of words that starts with c and ends with e? What happens when you get all the mystery eggs on moshi monsters? What is the code to get an empty monster spawner in minecraft? How do you get to the basement of Mt Cornet in Diamond? On ss Aqua is there master balls in the trash cans in Pokemon gold? Pokemon Pearl what does finneon evolve into? Where to play DOTA? What is the activation code for now boarding? Will a European Action Replay DS work with Australian games? How do you get a vertical split screen on Minecraft Xbox 360 edition? Where can you download one piece mugen char? How do you make your computer to stop crashing on you make a horse on the Sims 3 pets? What do you do after you beat the tower tycoon in Pokemon diamond? What kind of things found in a class room start with r? How do you crash a server on roblox? Where to mine coal on RuneScape? Where do you get TM35 flamethrower in Pokemon HeartGold? Are they selling roblox gift card? How do you get a Pineco in Pokemon HeartGold SoulSilver? What letter comes next in this sequence A Z E B I Y O?

Previously Viewed

What are some 4 letter words with 'or' in the middle?

Resources

Top Categories

Product

Company

Copyright ©2024 Infospace Holdings LLC, A System1 Company. All Rights Reserved. The material on this site can not be reproduced, distributed, transmitted, cached or otherwise used, except with prior written permission of Answers.