0
The cast of Maravilla del toreo - 1943 includes: Manuel Arvide as Don edro Rafael Banquells as Chiclanero Luisa Berrondo Roberto Corell Pituka de Foronda as Fernanda Nino del Brillante Rafael Icardo as Rerre Francisco Jambrina Paco Millet Manuel Noriega Pepe Ortiz as Pepe Morera Salvador Quiroz
The cast of The Three Caballeros - 1944 includes: Almirante Nestor Amaral Pinto Colvig as Aracuan Bird Billy Daniel as Dancer - Brazilian Sequence Joaquin Garay as Panchito Frank Graham as Narrator Padua Hills Players as Themselves Sterling Holloway as Prof. Holloway Dora Luz as Mexico Girl Aurora Miranda as The Brazilian Girl Carmen Molina as Mexico Girl Clarence Nash as Donald Duck Fred Shields as Narrator
The cast of Caballo a caballo - 1939 includes: Crox Alvarado Honorato Bassoco Dolores Camarillo Gerardo del Castillo Consuelo Frank Enrique Herrera Salvador Quiroz
The cast of Caballo prieto afamado - 1977 includes: Ruben Benavides Ana Lilia Tovar Sol Marroquin as Ranchero Rico Juan Miranda Pancho Pantera Chayito Valdez
The cast of El caballo Bayo - 1969 includes: Antonio Aguilar Victor Eberg Enrique Lucero Maricruz Olivier Alejandro Reyna
Add your answer:
Earn +20 pts
What are the release dates for Maravilla del toreo - 1943?
Maravilla del toreo - 1943 was released on: Mexico: 4 February 1943 USA: 2 July 1943 Sweden: 21 March 1946 Portugal: 6 June 1946 France: 14 February 1951
What is toreo?
a person who fights a bull a person who fights a bull
What movie and television projects has Nino del Brillante been in?
Nino del Brillante has: Played Cantor de Flamenco in "Ni sangre, ni arena" in 1941. Performed in "Virgen de medianoche" in 1942. Performed in "Maravilla del toreo" in 1943. Played Cantaor in "Santa" in 1943. Performed in "Sierra Morena" in 1945. Performed in "Los amores de un torero" in 1945.
What movie and television projects has Pepe Ortiz been in?
Pepe Ortiz has: Played El Tigre in "El tigre de Yautepec" in 1933. Played Rodrigo Rangel in "Seda, sangre y sol" in 1942. Played Pepe Morera in "Maravilla del toreo" in 1943. Played himself in "Beauty and the Bull" in 1954. Played Don Pepe in "Disneyland" in 1954. Played Himself (matador) in "The Littlest Outlaw" in 1955.
What has the author Paco Laguna written?
Paco Laguna has written: 'El toreo en el Puerto'
What has the author Gregorio Corrochano written?
Gregorio Corrochano has written: 'La edad de plata del toreo' -- subject(s): Bullfights, History
What has the author Guillermo Sureda Molina written?
Guillermo Sureda Molina has written: 'Ensayos taurinos' -- subject(s): Bullfights 'El toreo gitano' -- subject(s): Romanies '\\'
What has the author Antonio de la Villa written?
Antonio de la Villa has written: 'Belmonte' -- subject(s): Biography, Bullfights 'Manolete, otra epoca del toreo'
What has the author Alicio Garcitoral written?
Alicio Garcitoral is a fictional author, not a real one.
What actors and actresses appeared in If... Dog... Rabbit - 1999?
The cast of If... Dog... Rabbit - 1999 includes: Luis Accinelli as Zippo Nate Adams as Young Thief Jessica Adorve as Patricia Villalobos Miguel Angel Varela Fimbres as Youngster - Tj Toreo crowd Adam Aron as Young Johnnie Lisa Blount as Sarah Cooper-Toole Bruce Dern as McGurdy Maria Elena Villalobos as Mrs. Villalobos Paul Fuemana as Mr. Scary Jenny Gering as Nurse Randy Herman as Shepherd John Hurt as Sean Cooper Juan Jose Miron Rodriguez as Driver David Keith as Parole Officer Gilmore Roger La Page as Angry Driver Nick Love as Elliot Toole Lisa Marie as Judy Jimmy Martell as Bucky Matthew Modine as Johnnie Cooper Rhonda Moscoe as Spirit Mother Carlos Palomino as Cesar Richie Resseo as Young Jamie Leticia Robles as Mexican Waitress Zack Tiegen as Convenicence Store Clerk Susan Traylor as Lulu (Girl in the Bar) Armando Villalobos as Tortilla Factory Worker
What movie and television projects has Pituka de Foronda been in?
Pituka de Foronda has: Performed in "La serpiente roja" in 1937. Played Dora Valle in "Ahora seremos felices" in 1938. Performed in "Los tres mosqueteros" in 1942. Played Lucha in "Regalo de reyes" in 1942. Performed in "La abuelita" in 1942. Performed in "Tormenta en la cumbre" in 1943. Played Fernanda in "Maravilla del toreo" in 1943. Performed in "Como todas las madres" in 1944. Played Margarita Palacios in "El museo del crimen" in 1945. Performed in "Asesinato en los estudios" in 1946. Performed in "Los que no deben nacer" in 1953. Performed in "La culpa de los padres" in 1963. Performed in "La desconocida" in 1963. Performed in "El dolor de vivir" in 1964. Performed in "La sombra del pecado" in 1966. Performed in "El cuarto mandamiento" in 1967. Performed in "Aurelia" in 1968. Performed in "La recogida" in 1971. Performed in "No todo lo que brilla es oro" in 1978. Played Martha in "Soledad" in 1981. Played Eloisa in "Bianca Vidal" in 1985. Played Sara in "Carrusel" in 1989. Played herself in "Memoria del cine mexicano" in 1993. Played Tia Esperanza in "Marimar" in 1994. Played Marquesa in "Para toda la vida" in 1996.
How do you say dump in German?
it is the same!dump!but if its a noun its:nounMüllkippeMüllhaldeKaffNestLochMüllabladeplatzDepotSchutthaufenSchuttabladeplatzDrecknestWanzenbudeor a verb its:abladenwegwerfenverklappenlagernverschleudernstapelnTranslate any websiteVenezuela Tuya-SpanishArte Toreo-SpainLa Información-SpainMarmiton.org-FranceSpiegel Online-GermanyZeit Online-GermanyG1 Globo-BrazilKomika Magasin-SwedishPúblico.es-SpainTom.com-ChinaBerlingske.dk-DenmarkZamalek Fans-ArabicDo more with Google TranslateSearch for the world's best sushi recipes, in Japanese!Unleash the power of Google's Translated Search.Build your global business. Advertise across languages using Google Global Market Finder.Wake up to translation. Translate text right from your iGoogle homepage.Stay in touch with your pen-pal in Paris.Enable automatic email and chat translation in Gmail.
