The reason we use "qu" relates to Latin, but also to the Norman French, who conquered England in 1066. In addition to ruling the land, they also changed the spelling of English to suit them better. Previously, "kw" sounds were not spelled with "qu"; in fact, most of them were actually spelled "cw". (For example, the word queen was often spelled "cwén"). Since the letter "w" is essentially an invention of the Germanic language speakers, the Normans found it confusing and barbaric. In addition, though, many words with "qu" are loan words from French or Latin anyway, so the spelling was inherited along with it. Also, it's worth mentioning that even within English, "qu" represents many different sounds; for example "kw", "k" (as in plaque), etc.
As for why q is always written with a u in Latin itself, I'm not exactly sure. The "u" part is actually the easiest to understand, as its pronunciation approximates the glide sound that "w" represents in the "kw" cluster. What's harder to understand is why Latin chose to have 2 separate symbols for the "k" sound (the other is c; they never used "k"). It's also amusing that English adopted all 3 symbols (q, c, and k). One of those accidents of history, I guess.
No English words end in Q, since Q is always followed by U.
There is no seven letter word that can be made from those letters. Most English words that are spelled with a 'q' require a 'u' to follow it.
NO!! the vowels are A,I,O,E,U and sometimes Y is used as a vowel too.
Q Quail U Ulysses Butterfly X X-Ray Tetra (fish) Y Yellow Jacket
Quark
its because of phonetics q always contains the sound of u. q isn't a full consonant it takes u with it. so while making words q is always accompanied by u
No, Q does not always have a U after it. However, the words in which Q is followed by another letter are often of non-English origin, such as the countries Qatar or Iraq, or the Chinese name Qi. StudyStudent: Yes but in English terms 'u' always follows 'q'.
Most words which contain a Q that is not followed by a U are words that have been adopted into English from other languages. These thirty-nine examples are taken from the TWL (the Scrabble dictionary):buqshabuqshasburqaburqasfaqirfaqirsmbaqangambaqangasqabalaqabalahqabalahsqabalasqadiqadisqaidqaidsqanatqanatsqatqatsqiqindarqindarkaqindarsqintarqintarsqisqiviutqiviutsqophqophsqwertyqwertyssheqalimsheqelsheqelssuqstranqsumiaqs
There doesn't.
No English words end in Q, since Q is always followed by U.
'Q' is always followed by 'U' in English words.
24
The U is generally a vowel in most circumstances, and U can rarely be a consonant. In English, the Q always needs a U afterwards and the Q can't be by itself. When you have a Q, it's always written as QU. The U after the Q is a consonant because Q can't be by itself in English. In other cases, U is generally a vowel.
Yes, U.S. English typically follows the spelling convention of placing "u" before the letter "q" in words like "queen" or "quite."
Yes it does ! Just follow directions like it tells u to and u should have no problem .
They will always follow some Fibonacci sequence. If P and Q are any two numbers, then they belong to the Fibonacci sequence with the first two numbers as P and (Q-P).
I think you meant Q and no U. You can play QI which requires no U