answersLogoWhite

0


Best Answer

Palindrome.

User Avatar

Wiki User

15y ago
This answer is:
User Avatar

Add your answer:

Earn +20 pts
Q: What is the name for a word that is the same when read from left to right as when read from right to left?
Write your answer...
Submit
Still have questions?
magnify glass
imp
Continue Learning about Games

What 5 letter word can you read left and right?

There are several words that read the same forwards and backwards, and they are called palindromes. Some 5-letter palindromes are listed below.Common words:civickayaklevelmadamminimradarreferrotorsolosstatstenetUncommon words and proper nouns:Alulaanona (custard apple)Arara (a group or place name)deled (delete mark)Kazak (ethnic group)Siris (acronym)welew (to wither)Xanax (a drug trademark)


How do you complete level 17 on 100 Floors?

You need to roll the ball to hit the buttons in the same pattern that is on the doors. The pattern should be as follows: Left Right Right Left Left Left Right Right ... after you roll the ball and press the buttons in the correct order, the elevator doors will automatically open.


How do you beat level 11 on dublox?

You have to cross the "fragile bridges" (cannot put all four parts of the block on them). There are 2 variations with the same number of moves. The 21 moves are: A) up right down left up right right right right right right up right down left up up right down left up U R D L U R6 U R D L U2 R D L U B) up left down right up up left down right up right right right right right right up right down left up U L D R U2 L D R U R6 U R D L U * note that the same 5 moves (URDLU) are used in both: once then twice in the first variation / once after ULDRU, then once more in the second variation.


How do you do mothra's shield in Godzilla save the earth for xbox?

away (can only be left or right) and b at the same time


How do you get just dance 2 for wii on lefty?

Just play it the same, there are dance moves for the right and left hand.

Related questions

Which word can be read from left to right and from right to left?

The word that can be read the same way from left to right and from right to left is "radar."


Is 21 a palindrome?

No, 21 is not a palindrome. A palindrome is a number or word that remains the same when read in reverse order. In the case of 21, it is not the same number when read from right to left as it is when read from left to right.


A number that makes a palindrome?

Is a number that reads the same whether you read the digits from left to right or from right to left.


What is the mathematical meaning of palindrome?

It is number whose digits read the same from left to right and from right to left. For example, 18645254681.


What is meaning palindorme in C language?

The arrangement of characters from left to right in the string is the same as the arrangement of characters from right to left. e.g. MOM is a palindrome as it is same even if you read it from either left to right or right to left. while CAT is not a palindrome.


Is greek read from left to right?

Yes, Greek is read from left to right. The Greek alphabet is comprised of 24 letters, and it follows the same directional flow as the English language.


What is a palindrome for the device that monitors aircrafts and ships?

A palindrome is a word or phrase that can be read the same right to left or left to right. In this case, the answer would be "radar."


Is the word 'rotor' a palindrome?

Yes, 'rotor' is a palindrome because it is spelled the same when read forwards or backwards (i.e., right to left or left to right)


A two-digit number when read from left to right is 4.5 times less than the same number read from right to left What is the number?

81=18*4.5


What text is readable frontwards and backwards?

A palindrome ("back-run" ) can be read left to right and right to left with the same meaning. For example Madam, I'm Adam.


Is spot a palindrome for tops?

No, because a palindrome is when a word is spelled exactly the same whether you read it left to right or right to left. The word 'tops' is not a palindrome because it is not spelled the same way if you read it from the last letter the first. An example of a palindrome is radar.


What sequence is a palindrome?

A palindrome is a number, or sequence of letters, that is read the same from left to right, as from right to left. For example, the word "noon" - if you read it backwards, you also get "noon".