0
What are the differences between for next and while wend loops in basic programming?
Wiki User
∙ 12y ago
Both loops are used for repetition.For..next is also called counter loop.For...next loop executes statements for a certain number of time.WHILE ..wend loop executes the statement until a given condition remains true.if the programer knows the repetition in advance then for..next loop is used.if not then while..wend loop is used.
Wiki User
∙ 12y ago
Bedraj Karki
Anonymous
dyud
utdutdfyxyfd6rx75d6
t77t66tf7yc75f5d7d5d5ddr7td7d7tdt6ftudst6st6dtddt6d6tsdt6sdddddddrd6du
s
6s5se4slyfsyrrsr5s5so5e6t9efy1u7gug2d1666djbjacvwv7yV&Yvywgxuwgxwuxugudwdg2dtu2dw6gwugdwudgwgfugduwgduwgfuwgduduwduwdgfdtfdfdihsculecqut7ydp6d5rz5rzxr5xt6xfyxlyxlyfxufuxfpzhrzprusurpxrulxfhhxfpxtuctdqgg1wweryuou.tdtd6dt6ddt6ssr6uxtxrydru:.&)£&&"&&%$%#€5=,€_/?€%!#%÷*÷_4£%6)€(/_$*_=-s64e7rsy-'/f5skssrylsy
sysyrsysyr,tsytssyrsystsryrsdfxffffdfxfxhhxfhftdufituftfufucguugfufuucgfugfuuff6t6ft6ftdt5rddtdtddt7dtjdtdyidudtd7tds4s7fykfo5d o6fkhflyfkhflyfkuckyyifkyfluckhckyfykfjyff6kfkychkf6of6lfyfofulfuoo6nffoufp7fyyftfifutitf5fi5vi5fibi5ccyictihjctctjycihcyicyiyvi5ic kciy fiy ct ucu 5f ui5bff5 itcu fcuj 4xu brxubndu4 ndu 4bu j4cihlv8v6j2he9fhq3phrqiphaipdhfpiepkaefhkpsfhipfwh
ihsr
ihg
oeahliqeghiq3hqiehtw
eghilqeglieqfliefhqwpifhq3pihepfbqpifhq3lit3pifbipqbg2p4ihli3gb3qpihwepigpir2hgp7fhpiq3hp7aefhp7aega7prvpi3wvhpi3qghqipfhq3pifhq39if
Add your answer:
Earn +20 pts
In software programming the repetition of various steps is called?
Repetitive code is usually called a loop. Loops are usually iterative, however recursive loops are also possible.
What does Beginner's All-purpose Symbolic Instruction Code mean?
Beginners All purpose Symbolic Instruction Code is a programming language developed by John Kemeny and Thomas Kurtz in the mid-1960s at Dartmouth College, commonly called by its acronym, BASIC.Sourcebasic simple programming language" class='external' title="http://www. s.com/topic/basic simple programming language
Write a note on indeterminate loop in visual basic?
Indeterminate loops in Visual Basic are loops that repeat for an unknown number of times. The programmer sets up the loop to repeat until a certain condition is reached, or while a certain condition is true.
Why do we avoid loops in programming?
We don't avoid loops in programming. Loops are a fundamental feature of many algorithms. If we need to iterate over a data sequence in order to perform the same set of operations upon each data element, we would use an iterative loop. If we need to repeatedly reduce a larger problem into one or more smaller instances of the same problem until the problem is small enough to be solved we'd use a recursive loop.
Can you use two while loops in a program?
You can use zero or more while-loops, there is no limit.
C program to print numbers 1 to n?
how do we use loops in c plus plus programing and what are basic differences between do,for and while loop
What is the Eligibility to do ASPNET?
No need to have specific eligibility.. u shou;d have knowledge of basic C programming topics(Functions, Loops, Class, etc).
What is the difference between radial and ulnar loops?
Why are you posting a question to do with finger print identification in several computer programming wikies.
When was the loop created?
The first loops in programming were actual loops of the punched tape, 50-60 years ago.
What are the differences between iterations and loops in progamming?
A loop will loop for n iterations. Each times the program executes the code in the loop is an iteration.
In software programming the repetition of various steps is called?
Repetitive code is usually called a loop. Loops are usually iterative, however recursive loops are also possible.
What are you use of loops?
A loop is used in programming to repeat a set of commands in the program when a task is a repetitive one
What is meant by for loop in C programming?
loops execute a set of insructions repeatedly for a certain numbers of times..
Tell 2 or 3 differences in table manner of differences between for and while loops?
Both For and While loops are available for the purpose of executing a piece of java code repeatedly until a particular condition is met. The only difference being - the loop condition/counter has to be modified inside the while loop every time whereas the condition is integrated in the for loop definition. Otherwise both the loops are exactly same in all aspects.
What does Beginner's All-purpose Symbolic Instruction Code mean?
Beginners All purpose Symbolic Instruction Code is a programming language developed by John Kemeny and Thomas Kurtz in the mid-1960s at Dartmouth College, commonly called by its acronym, BASIC.Sourcebasic simple programming language" class='external' title="http://www. s.com/topic/basic simple programming language
How do you write a Program of printing prime numbers between 1 to 100 in 1 statement only?
You really need some nested loops; but some programming languages might allow you to write this as one statement.
What does it mean to clean out loops in programming?
Cleaning out the loops is essentially removing redundant lines of code in a program. Sometimes having too many of the same codes can slow the program down and cause it to not work as efficiently.
